PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011083731.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family BES1
Protein Properties Length: 324aa    MW: 34640.7 Da    PI: 8.7183
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011083731.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822219.29.2e-68241551133
          DUF822   1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssasaspesslq 95 
                     g+++rkp+w+ErEnn+rRERrRRaiaakiyaGLRaqGny+lpk++DnneVlkALc+eAGw+ve+DGttyrkg+kp   +e++g+sa+++p+ss +
  XP_011083731.1  24 GAGRRKPSWRERENNRRRERRRRAIAAKIYAGLRAQGNYNLPKHCDNNEVLKALCAEAGWIVEPDGTTYRKGCKPC-PMEIGGTSANITPSSSRN 117
                     6899************************************************************************.****************** PP

          DUF822  96 sslkssalaspvesysaspksssfpspssldsislasa 133
                      s+ ss++asp++sy++sp+sssfpsps+ d + ++++
  XP_011083731.1 118 PSPPSSYFASPIPSYQPSPSSSSFPSPSRRDANASSHP 155
                     *******************************9987654 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056872.8E-6226150IPR008540BES1/BZR1 plant transcription factor, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009742Biological Processbrassinosteroid mediated signaling pathway
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048316Biological Processseed development
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MMWEAGGSTA SSSAAGGAGG SGGGAGRRKP SWRERENNRR RERRRRAIAA KIYAGLRAQG  60
NYNLPKHCDN NEVLKALCAE AGWIVEPDGT TYRKGCKPCP MEIGGTSANI TPSSSRNPSP  120
PSSYFASPIP SYQPSPSSSS FPSPSRRDAN ASSHPFAFLL NSIPSSLPPL RISNSAPVTP  180
PLSSPTRLPK QTFNLETLAQ ESMSALNIPL FAASAPASPI RGQRFTPATI PECDESDTST  240
IDSGQWMNFQ AYANATGAVP TSPTFNLMKP VAHEVPPKDA IMSDKGKGTE FDFENMAVKP  300
WEGERIHEVG MDDLELTLGS GNTR
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12645RRKPSWRERENNRRRERRRR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00237DAPTransfer from AT1G75080Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011083731.10.0PREDICTED: protein BRASSINAZOLE-RESISTANT 1
SwissprotQ8S3071e-117BZR1_ARATH; Protein BRASSINAZOLE-RESISTANT 1
TrEMBLA0A0F6VYB21e-155A0A0F6VYB2_NICBE; BES1/BZR1
STRINGPGSC0003DMT4000398791e-152(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA28122454
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75080.26e-94BES1 family protein